PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_23240
Common NameKK1_023920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 224aa    MW: 24777.3 Da    PI: 7.6194
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_23240genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.75.4e-5631126297
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                    +eqdrflPianvsrimk++lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plk yl+ yre+egek
  C.cajan_23240  31 KEQDRFLPIANVSRIMKRALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKHYLNSYRETEGEK 126
                    89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.5E-5426143IPR009072Histone-fold
SuperFamilySSF471138.38E-4133140IPR009072Histone-fold
PfamPF008082.7E-2736100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.1E-186482No hitNo description
PROSITE patternPS0068506783IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.1E-1883101No hitNo description
PRINTSPR006153.1E-18102120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MTGKRNQNQN QSSPVGSPTS GGNISDSSSS KEQDRFLPIA NVSRIMKRAL PANAKISKEA  60
KETVQECVSE FISFITGEAS DKCQREKRKT INGDDLLWAM TTLGFENYVG PLKHYLNSYR  120
ETEGEKSSVA KQEEQYSPTH QQNDHGVVHE INKLLPHSSV TTNKPDFNTF GGGFYSVGPQ  180
VSAQSYRESS MNRVIAQSAA NGGDPDDASA NRMVPPNLRY RVEW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4731121292Transcription factor HapC (Eurofung)
4g92_B2e-4731121292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524282.11e-114PREDICTED: nuclear transcription factor Y subunit B-2-like
SwissprotO233102e-63NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A151TKQ31e-169A0A151TKQ3_CAJCA; Nuclear transcription factor Y subunit B-3
STRINGGLYMA05G31681.11e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-62nuclear factor Y, subunit B3